← Immune Health

LL-37

What the Research Actually Shows

Human: 2 studies, 12 groups · Animal: 5 · In Vitro: 5

HUMAN ANIMAL IN VITRO TIER 3

The only antimicrobial peptide your body makes — controlled by vitamin D, tested in two wound trials, and carrying a cancer paradox that changes everything about how you should think about immune defense

EDUCATIONAL NOTICE: Peptidings exists to make peptide research accessible and honest — not to tell you what to take. The information on this site is for educational and research purposes only. It is not medical advice, and no material here is intended to diagnose, treat, cure, or prevent any disease or health condition. Consult a qualified healthcare provider before making any decisions about peptide use.

AFFILIATE DISCLOSURE

This article contains links to partner services. We may earn a commission if you purchase through them, at no cost to you. This never influences our evidence assessments or editorial content. Full policy →

BLUF: Bottom Line Up Front

1Approved Drug 2Clinical Trials 3Pilot / Limited Human Data 4Preclinical Only ~It’s Complicated
Eyes Open — Two small wound-healing trials, zero injectable evidence, and a cancer paradox that defines the compound
Strong Foundation Reasonable Bet Eyes Open Thin Ice

LL-37 is the only germ-fighting peptide your body produces. It kills bacteria, viruses, and fungi on contact — and your vitamin D level directly controls how much of it you make. Two small clinical trials tested it on skin wounds that would not heal, and the lower dose worked about six times better than a placebo. That is the only human evidence that exists. Nobody has ever tested LL-37 injections in a clinical trial. The compound also has a serious dark side: at certain doses, it helps some cancers grow faster. If you are considering LL-37 for immune support, you need to understand both what it can do and what it might do that you do not want.

Every living organism faces the same fundamental challenge: how to defend itself against microbial invasion without destroying its own tissues in the process. Humans solved this problem partly through cathelicidins — a family of antimicrobial peptides expressed across virtually all mammalian species. LL-37 is the only cathelicidin humans produce, and it is arguably the most versatile innate immune molecule in the human body: a 37-amino-acid peptide that kills bacteria, neutralizes viruses, disrupts fungal membranes, recruits immune cells to infection sites, promotes wound healing, and modulates the inflammatory response.

What makes LL-37 uniquely relevant to immune health — and what the existing Cluster B article on this compound underemphasizes — is the vitamin D connection. The human CAMP gene that encodes LL-37 contains a vitamin D response element in its promoter region. Active vitamin D (1,25-dihydroxyvitamin D3) directly upregulates LL-37 expression. This is why vitamin D deficiency correlates with increased susceptibility to infections: when your vitamin D drops, your LL-37 production drops with it, and your first-line antimicrobial defense weakens. The vitamin D–LL-37 axis is one of the best-characterized molecular links between a common nutrient deficiency and immune vulnerability.

The challenge with LL-37 as a therapeutic compound is the gap between its endogenous role and exogenous administration. Your body produces LL-37 at precise concentrations in specific tissues. The two published clinical trials tested topical application to chronic wounds — not systemic injection. The community practice of injecting LL-37 subcutaneously for immune support has zero clinical trial backing. And the cancer paradox — LL-37 promotes tumor growth in several cancer types at concentrations that overlap with therapeutic dosing — makes this compound one where the gap between fascinating biology and safe therapeutic use is wider than most people realize.

Quick Facts: LL-37 at a Glance

Type

Endogenous antimicrobial peptide; the only human cathelicidin

Also Known As

hCAP18 (precursor), CAMP (gene name), cathelicidin antimicrobial peptide, FALL-39 (earlier designation)

Generic Name

LL-37 / cathelicidin LL-37

Brand Name

None — no commercial pharmaceutical product exists

Molecular Weight

~4,493 Da (37 amino acids, cationic alpha-helical)

Peptide Sequence

[LL-37, 37 aa] (37 aa; cleaved from hCAP18 by proteinase 3)

Endogenous Origin

Expressed in neutrophils (stored in specific granules), macrophages, epithelial cells (skin, respiratory, urogenital, GI tract), mast cells, and NK cells. Expression directly regulated by vitamin D via CAMP gene promoter.

Primary Molecular Function

Multifunctional innate immune effector: (1) direct membrane disruption of bacteria, viruses, fungi; (2) immunomodulation via TLR signaling and chemotaxis; (3) wound healing via FPRL1/EGFR/P2X7; (4) tissue-specific cancer modulation (pro- and anti-tumorigenic)

Vitamin D Connection

Active vitamin D (1,25(OH)₂D₃) directly upregulates LL-37 expression through a vitamin D response element (VDRE) in the CAMP gene promoter. This is the molecular basis for vitamin D's role in innate immunity.

Antimicrobial Spectrum

Broad: gram-positive bacteria, gram-negative bacteria, enveloped viruses (RSV, influenza), Candida species. Synergistic with conventional antibiotics (70% synergy with fluconazole, 100% with amphotericin B/caspofungin).

Half-Life

Short in plasma (rapid enzymatic degradation); relatively stable in wound fluid (~24 hours ex vivo, PMID 21547341). No pharmacokinetic data for injectable route in humans.

Route of Administration

Topical (clinical trial data); subcutaneous/IV (community experimentation only — zero clinical data for systemic routes)

Clinical Evidence Summary

Two small RCTs: venous leg ulcers (N=34, topical, PMID 25041740) and diabetic foot ulcers (N≈40, topical, PMID 37480520). Both topical only. Zero injectable human data.

FDA Status

Not approved for any indication. No IND filed for systemic use.

WADA Status

Not specifically prohibited. Does not fall under S2 or other current prohibited categories.

Cancer Warning

Pro-tumorigenic at ~5 μg/mL in ovarian, lung, breast, prostate cancer, melanoma, and skin SCC. Anti-tumorigenic at higher concentrations in colon, gastric, and hematologic cancers. Tissue-specific and concentration-dependent — this is not a footnote, it is a central safety concern.

Evidence Tier

3 Pilot / Limited Human Data

Verdict

Eyes Open

The research moves fast. We read all of it so you don’t have to.

New compound reviews, evidence updates, and protocol analysis — sourced, cited, and written for people who actually read the studies.

Subscribe to Peptidings Weekly

What Is Ll-37?

Pronunciation: ell-ell thirty-seven

You are colonized by approximately 38 trillion bacteria right now — on your skin, in your gut, in your respiratory tract. Most are harmless or beneficial. But at every mucosal surface, your body maintains a chemical defense perimeter against the ones that are not. LL-37 is the centerpiece of that perimeter: the only antimicrobial peptide in the cathelicidin family that humans express, and one of the most versatile innate immune molecules ever characterized.

The name is straightforward: LL-37 is 37 amino acids long, and it begins with two leucine residues (L-L). It is cleaved from a larger precursor protein called hCAP18 (18 kDa human cationic antimicrobial protein) by the enzyme proteinase 3, primarily inside neutrophils — the white blood cells that arrive first at any infection site. When neutrophils degranulate at a wound or infection, they release LL-37 along with a cocktail of other antimicrobial molecules, creating a chemical killing zone.

But LL-37 is not just a neutrophil weapon. It is expressed in epithelial cells across the skin, respiratory tract, urogenital tract, and gastrointestinal tract — every surface where your body meets the outside world. It is produced by macrophages, mast cells, and natural killer cells. And uniquely among antimicrobial peptides, its production is directly controlled by vitamin D: the active form of vitamin D (1,25-dihydroxyvitamin D3) binds to a vitamin D response element in the CAMP gene promoter and upregulates LL-37 transcription. This molecular link between vitamin D status and innate immune defense is one of the most important discoveries in modern immunology.

PLAIN ENGLISH

LL-37 is your body's built-in antibiotic. It sits at every surface where germs could enter — your skin, your lungs, your gut — and kills bacteria, viruses, and fungi on contact. The amount your body makes depends directly on your vitamin D level. When vitamin D is low, LL-37 production drops, and your first line of immune defense weakens. That is why vitamin D deficiency is linked to more infections — LL-37 is the molecular explanation.

Origins and Discovery

The cathelicidin family was identified in the early 1990s through work on antimicrobial peptides stored in neutrophil granules. The human member — originally designated FALL-39 (later corrected to LL-37 after sequencing refinements) — was characterized by Gudmundsson et al. in 1996. The realization that humans expressed only a single cathelicidin, compared to dozens in other species, focused intense research attention on LL-37's multifunctionality.

The vitamin D connection was established in 2006 by Liu et al. in a landmark Science paper demonstrating that TLR activation of macrophages led to upregulation of the vitamin D receptor and the 1-alpha-hydroxylase enzyme, which in turn induced LL-37 expression. This study provided the first molecular mechanism explaining why vitamin D supplementation reduced infection risk — a connection that had been observed epidemiologically for over a century (the use of sunlight and cod liver oil for tuberculosis treatment predates the discovery of vitamin D itself).

The dual nature of LL-37 — antimicrobial defender and potential tumor promoter — was characterized over the following decade, with multiple groups demonstrating concentration- and tissue-dependent effects on cancer cell growth. This duality transformed LL-37 from a straightforward "good" immune molecule into one of the most pharmacologically complex peptides in the human body.

PLAIN ENGLISH

Scientists discovered LL-37 by studying the granules inside white blood cells — the tiny packets of chemicals that neutrophils release to kill bacteria. The breakthrough came when researchers realized that vitamin D controls how much LL-37 you make. That explained something doctors had noticed for over a hundred years: people with more sun exposure got fewer infections. The molecular reason turned out to be this peptide.

Mechanism of Action

LL-37 operates through at least four distinct biological mechanisms, each relevant to immune health:

Direct Antimicrobial Activity — The First Line

LL-37 is a cationic (positively charged) alpha-helical peptide that kills microbes through electrostatic disruption of their membranes. Bacterial and fungal cell membranes are negatively charged (due to lipopolysaccharide in gram-negatives, lipoteichoic acid in gram-positives, and ergosterol in fungi), while human cell membranes are relatively neutral. LL-37 exploits this charge difference: it binds to negatively charged microbial membranes, inserts its alpha-helical structure, and creates pores that destroy membrane integrity. The microbe dies by losing control of its internal environment.

The antimicrobial spectrum is remarkably broad. LL-37 is effective against gram-positive bacteria (including MRSA — PMID: PMC 8532939), gram-negative bacteria, enveloped viruses (RSV — PMID 26732674; influenza A — PMID 23052388), and fungi including the emerging pathogen Candida auris (PMID 35205958). It also shows synergy with conventional antibiotics: 70% synergy with fluconazole, 100% synergy with amphotericin B and caspofungin (PMID 35205958).

PLAIN ENGLISH

LL-37 kills germs by punching holes in their outer membranes. It works because bacteria and fungi have negatively charged surfaces while human cells do not — so LL-37 targets the right cells. It works against bacteria (including antibiotic-resistant MRSA), viruses (including flu), and fungi. It even makes conventional antibiotics work better when used together.

Immunomodulation — The Signaling Role

Beyond direct killing, LL-37 functions as an immune signaling molecule. It acts as a chemoattractant for neutrophils, monocytes, and T-cells — recruiting additional immune cells to infection sites. It modulates Toll-like receptor (TLR) signaling, shaping the inflammatory response. It promotes dendritic cell differentiation, bridging innate and adaptive immunity. And it neutralizes lipopolysaccharide (LPS), the bacterial endotoxin that triggers septic shock — LL-37 binds LPS and prevents it from activating the inflammatory cascade.

This immunomodulatory role means LL-37 does not simply kill pathogens — it orchestrates the immune response to pathogens. It recruits reinforcements, shapes the type of immune response that develops, and prevents the inflammation from spiraling out of control.

PLAIN ENGLISH

LL-37 does not just kill germs directly — it also calls for backup. It attracts other immune cells to the infection site, helps the immune system decide how to respond, and prevents the kind of runaway inflammation that can cause more damage than the infection itself.

Wound Healing — A Downstream Consequence of Immune Defense

The wound-healing activity of LL-37 — the primary focus of the existing clinical trials — is mechanistically linked to its immune function. Wound healing requires angiogenesis (new blood vessel formation), which LL-37 promotes through FPRL1 (formyl peptide receptor-like 1). It requires epithelial migration and proliferation, which LL-37 drives through EGFR transactivation. And it requires infection control, which LL-37 provides through its direct antimicrobial activity.

In the immune health frame, wound healing is not a separate function — it is what happens when LL-37's immune defense activity is applied to damaged tissue. The same peptide that kills bacteria at a wound also recruits the cells that repair the damage and builds the blood vessels that supply the healing tissue.

The Cancer Paradox — Concentration-Dependent Dual Role

LL-37's effects on cancer are the most pharmacologically complex aspect of the compound. At approximately 5 μg/mL — a concentration achievable through exogenous administration — LL-37 acts as a growth factor for ovarian, lung, breast, and prostate cancers, malignant melanoma, and skin squamous cell carcinoma. The mechanism in ovarian cancer involves recruitment of multipotent mesenchymal stromal cells into the tumor stroma (PMID 19234121), enhancing tumor angiogenesis and promoting cancer cell proliferation.

At higher concentrations, LL-37 demonstrates anti-tumorigenic effects in colon cancer, gastric cancer, hematologic malignancies, and oral squamous cell carcinoma (PMID 26395996). In pancreatic cancer, LL-37 inhibits tumor growth by suppressing autophagy and reprogramming the tumor immune microenvironment (PMC: 9355328).

This duality is not a minor caveat — it is a central pharmacological feature. The same peptide that defends against infection can promote tumor growth, depending on the tissue and the dose. Any discussion of exogenous LL-37 administration must grapple with this paradox.

PLAIN ENGLISH

Here is the hard truth about LL-37: at the same doses that might boost your immune defense, it can help certain cancers grow faster — specifically ovarian, lung, breast, prostate, and skin cancers. At higher doses, it fights other cancers. Nobody knows which effect you would get from an injection. This is why the cancer paradox is not a footnote — it is the central reason why injecting LL-37 without clinical data is a gamble with undefined stakes.

Key Research Areas and Studies

The Vitamin D–LL-37 Axis — The Immune Health Foundation

The discovery that vitamin D directly regulates LL-37 expression is arguably the most important finding for immune health. The CAMP gene contains a vitamin D response element (VDRE) in its promoter region, and active vitamin D (1,25(OH)₂D₃) binds this element to upregulate transcription. Liu et al.'s 2006 Science paper demonstrated the complete signaling chain: TLR activation → vitamin D receptor upregulation → 1-alpha-hydroxylase induction → local vitamin D activation → LL-37 expression. This means your innate immune system's antimicrobial defense is directly coupled to your vitamin D status.

The clinical implications are substantial. Vitamin D deficiency (serum 25(OH)D < 20 ng/mL) affects an estimated 1 billion people worldwide and is associated with increased susceptibility to respiratory infections, tuberculosis, and other infectious diseases. The LL-37 mechanism provides the molecular explanation: when vitamin D drops below the threshold needed to maintain adequate LL-37 expression, the body's first-line antimicrobial defense weakens.

Antimicrobial Research — Breadth and Synergy

LL-37's antimicrobial activity has been characterized against a wide range of pathogens. Key findings include:

  • MRSA: Effective in a mouse wound infection model (PMC: 8532939), relevant given the crisis of antibiotic-resistant infections
  • RSV: Inhibited respiratory syncytial virus in polarized airway epithelium models (PMID 26732674)
  • Influenza A: Dose-dependent neutralization of multiple influenza A strains (PMID 23052388)
  • Candida auris: Triggered oxidative stress and cell cycle arrest in this emerging multidrug-resistant fungal pathogen (PMID 35205958)
  • Antibiotic synergy: 70% synergy rate with fluconazole, 100% with amphotericin B and caspofungin — suggesting LL-37 could enhance conventional antifungal therapy

Wound Healing — The Clinical Evidence Base

The venous leg ulcer RCT (PMID 25041740, 2014) remains the landmark clinical study: 34 patients, randomized, double-blind, placebo-controlled. Topical LL-37 at 0.5 mg/mL produced 68% mean ulcer area reduction — approximately sixfold faster healing than standard care. Higher doses (1.6 and 3.2 mg/mL) were less effective, demonstrating an inverted dose-response curve consistent with LL-37's concentration-dependent biology.

The diabetic foot ulcer RCT (PMID 37480520, 2023) confirmed topical efficacy in a different wound type and population.

Cancer Biology — The Defining Complication

The dual pro/anti-tumorigenic effects of LL-37 have been characterized across multiple tissue types (PMID 26395996, PMID 29843147). The pro-tumorigenic effects at physiologically relevant concentrations (~5 μg/mL) in ovarian, lung, breast, prostate cancers and melanoma represent a genuine safety signal that any immune health application must address.

PLAIN ENGLISH

The most important LL-37 research for immune health is not the wound trials — it is the vitamin D connection. Your body uses vitamin D to control LL-37 production. When your vitamin D is low, your natural antimicrobial defense drops. For most people, optimizing vitamin D may be a safer and more evidence-backed way to support LL-37 levels than injecting the peptide directly.

The Innate Immune Defense System — Where Ll-37 Fits

To understand LL-37's role in immune health, it helps to understand the defense system it belongs to. The innate immune system is the body's first responder — it operates within minutes of pathogen contact, requires no prior exposure to the invader, and uses a repertoire of germline-encoded receptors (TLRs, NODs, RIG-I) to detect common microbial patterns.

Antimicrobial peptides (AMPs) are the innate immune system's chemical weapons. They are produced at every mucosal surface and released by immune cells at infection sites. Humans produce two major families: defensins (alpha and beta) and cathelicidins. LL-37 is the sole human cathelicidin — and it is the most functionally versatile AMP in the human arsenal.

What distinguishes LL-37 from other AMPs is its multifunctionality. Most defensins are primarily antimicrobial — they kill microbes. LL-37 kills microbes AND modulates the immune response AND promotes tissue repair AND signals to adaptive immune cells. It is not just a weapon; it is a coordinator. When LL-37 is released at an infection site, it simultaneously kills pathogens, recruits neutrophils and macrophages, shapes the developing immune response, and initiates the tissue repair process that will follow once the infection is controlled.

This is why LL-37 belongs in both Cluster B (Injury Recovery) and Cluster F (Immune Health). Wound healing is what LL-37 does after the immune defense phase succeeds. Immune defense is the primary function; tissue repair is the follow-through.

PLAIN ENGLISH

Your body has a chemical defense system at every surface where germs could enter. LL-37 is the star player in that system — it is the only peptide of its kind that humans make, and it does more jobs than any other antimicrobial molecule: killing germs, calling for help, directing the immune response, and starting the repair process. That is why this one peptide appears in both the injury recovery and immune health sections of Peptidings.

Claims vs. Evidence

ClaimWhat the Evidence ShowsVerdict
“"LL-37 kills bacteria, viruses, and fungi"”Extensively demonstrated in vitro and in animal models. Broad-spectrum antimicrobial activity against gram-positive, gram-negative bacteria, enveloped viruses (RSV, influenza), and fungi (including Candida auris). Synergistic with conventional antibiotics.Supported
“"LL-37 heals wounds faster"”Two small RCTs — venous leg ulcers (N=34, 6× faster at 0.5 mg/mL) and diabetic foot ulcers (N≈40). Both topical only. Consistent with animal wound healing models.Mixed Evidence
“"Injecting LL-37 boosts your immune system"”Zero clinical trials of injectable LL-37 in humans. No pharmacokinetic data for SC or IV routes. The immune-modulating properties are characterized in vitro and in animal models only. Route matters: topical wound data does not validate systemic immune claims.Preclinical Only
“"LL-37 fights Lyme disease"”No published human or animal study of LL-37 for Borrelia burgdorferi infection. LL-37 has in vitro activity against some spirochetes, but this has not been tested for Lyme specifically. Community use for chronic Lyme is entirely anecdotal.Unsupported
“"Vitamin D boosts LL-37 production"”Well-established molecular mechanism. Active vitamin D upregulates CAMP gene transcription via vitamin D response element. Replicated across multiple labs. This is one of the strongest evidence claims for LL-37.Supported
“"LL-37 is safe to inject"”No injectable safety data in humans. The two clinical trials used topical application only. The cancer promotion concern at achievable concentrations is a genuine safety signal. No pharmacokinetic data for systemic routes.Unsupported
“"LL-37 potentiates antibiotics"”Demonstrated in vitro: 70% synergy with fluconazole, 100% with amphotericin B and caspofungin (PMID 35205958). No human study of combination therapy.Preclinical Only
“"LL-37 protects against respiratory infections"”In vitro neutralization of RSV (PMID 26732674) and influenza A (PMID 23052388). The vitamin D–LL-37 axis correlates with respiratory infection risk epidemiologically. No human intervention trial of exogenous LL-37 for respiratory infections.Preclinical Only
“"LL-37 can treat skin conditions"”LL-37 is ELEVATED in psoriasis and rosacea — it is part of the disease process, not the cure. Exogenous LL-37 could theoretically worsen autoimmune skin conditions.Unsupported
“"LL-37 has no cancer risk at therapeutic doses"”Directly contradicted by published evidence. Pro-tumorigenic at ~5 μg/mL in ovarian, lung, breast, prostate cancers and melanoma (PMID 19234121, 20977442). Dose overlaps with concentrations achievable by exogenous administration.Unsupported
“"Higher doses of LL-37 work better"”The clinical trial found an INVERTED dose-response: 0.5 mg/mL worked best; 3.2 mg/mL was no better than placebo. LL-37's biology is concentration-dependent — more is demonstrably not better.Unsupported
“"LL-37 is the body's most important antimicrobial peptide"”It is the only human cathelicidin and one of the most versatile AMPs characterized. Whether it is "most important" depends on context — defensins are also critical. But LL-37's multifunctionality (antimicrobial + immunomodulatory + wound healing) is unique among human AMPs.Mixed Evidence

We currently don’t have any vetted partners for this compound. Check back soon.

The Human Evidence Landscape

The human evidence for LL-37 is limited to two small clinical trials, both using topical application for chronic wound healing:

Venous Leg Ulcer RCT (2014, PMID 25041740)

Design: Randomized, double-blind, placebo-controlled Phase I/II trial. 34 patients with hard-to-heal venous leg ulcers. Three-week open-label placebo run-in, followed by four-week treatment phase. Three dose arms (topical LL-37 at 0.5, 1.6, or 3.2 mg/mL) plus placebo, applied twice weekly.

Key findings: The 0.5 mg/mL group achieved 68% mean ulcer area reduction — approximately sixfold faster healing than the placebo group. Higher doses (1.6 and 3.2 mg/mL) were progressively less effective, with 3.2 mg/mL performing no better than placebo. This inverted dose-response curve is consistent with LL-37's concentration-dependent biology.

Limitations: Small sample (34 patients). Single center. Four-week treatment phase. First-in-human trial — primarily designed for safety, not definitive efficacy.

Diabetic Foot Ulcer RCT (2023, PMID 37480520)

Design: Randomized, double-blind, controlled trial. Diabetic foot ulcer patients with mild infection in Jakarta, Indonesia. Topical LL-37 cream versus placebo cream, twice weekly for four weeks.

Key findings: Enhanced wound healing rate and decreased inflammatory markers in the LL-37 group.

Limitations: Single center, specific population (diabetic patients with infected wounds in Southeast Asia). Small sample.

The Critical Route Gap

Both trials used topical application to chronic wounds. No published human data exists for subcutaneous, intramuscular, or intravenous LL-37. The community practice of injecting LL-37 for systemic immune modulation has zero clinical trial support. Topical delivery to a wound bed — where LL-37 acts locally on exposed tissue — is a fundamentally different pharmacological scenario than systemic injection, where the peptide must survive plasma degradation, distribute to target tissues, and achieve effective concentrations without triggering the cancer-promoting effects documented at ~5 μg/mL.

PLAIN ENGLISH

Two small studies — 34 people with leg wounds, about 40 people with foot wounds — tested LL-37 applied directly to the skin. Both showed it helped wounds heal. That is the entire human evidence base. Nobody has ever studied LL-37 injections in people. If you inject it, you are the clinical trial, and you are running that trial without any of the safety monitoring that a real trial would provide.

Safety, Risks, and Limitations

Topical Safety (Clinical Data)

Both RCTs reported no serious adverse events from topical LL-37 application. Mild local reactions at the application site were the only notable findings. No systemic toxicity was observed — but topical application delivers minimal systemic exposure.

The Cancer Promotion Risk

This is not a theoretical concern — it is demonstrated biology. LL-37 at approximately 5 μg/mL acts as a growth factor for ovarian, lung, breast, prostate cancers, malignant melanoma, and skin squamous cell carcinoma. The mechanism in ovarian cancer is well-characterized: LL-37 recruits multipotent mesenchymal stromal cells into the tumor stroma (PMID 19234121), creating a microenvironment that supports tumor growth.

The concentration at which these pro-tumorigenic effects occur (~5 μg/mL) overlaps with concentrations potentially achievable through exogenous administration. Anyone with an existing or occult malignancy in an LL-37-responsive tissue could theoretically accelerate tumor progression through exogenous LL-37. This is not a hypothetical scenario — it is a documented mechanism operating at clinically relevant concentrations.

CRITICAL DISCLAIMER

LL-37 promotes tumor growth in ovarian, lung, breast, prostate cancers, melanoma, and skin squamous cell carcinoma at concentrations of approximately 5 μg/mL. These concentrations overlap with those achievable through exogenous administration. If you have a personal or family history of these cancers, or if you have not been screened, the risk-benefit calculation for exogenous LL-37 shifts significantly.

Autoimmune Activation Risk

LL-37 is pathologically elevated in psoriasis and rosacea. In psoriasis, LL-37 forms complexes with self-DNA that activate plasmacytoid dendritic cells via TLR9, driving the autoimmune inflammatory cascade. In rosacea, excessive LL-37 production and aberrant processing by kallikrein 5 produces inflammatory fragments that cause the characteristic facial redness and papules.

This means LL-37 is not merely associated with these conditions — it is mechanistically involved in their pathology. Exogenous administration could theoretically worsen existing autoimmune skin conditions.

No Injectable Pharmacokinetic Data

No published data exists for the absorption, distribution, metabolism, and excretion of subcutaneously or intravenously administered LL-37 in humans. The peptide has a short plasma half-life due to enzymatic degradation. Whether injectable LL-37 achieves effective tissue concentrations, which tissues it reaches, and how long it persists are entirely unknown.

PLAIN ENGLISH

Three safety concerns define LL-37. First, it can help certain cancers grow — this is proven in the lab, not just a theory. Second, it is part of the disease process in psoriasis and rosacea — more LL-37 makes these conditions worse. Third, nobody has measured what happens when you inject it — where it goes, how long it lasts, what concentration it reaches. The safest way to support your LL-37 levels is through adequate vitamin D, which lets your body control the production naturally.

FDA Status: Not approved for any indication. No IND (Investigational New Drug application) has been filed for systemic use. Topical wound healing applications have been tested in Phase I/II clinical trials, but no FDA marketing authorization exists.

International: No regulatory approval in any jurisdiction for exogenous therapeutic use of LL-37.

WADA Status: Not specifically prohibited. LL-37 does not fall under S2 (Peptide Hormones, Growth Factors, Related Substances and Mimetics) or other currently prohibited categories. Athletes should verify current status annually through the WADA Prohibited List.

Compounding Access (US): LL-37 was placed in FDA Category 2 (do not compound) in 2023. The February 2026 HHS announcement indicated potential reclassification of some Category 2 peptides; LL-37's final disposition under this review is pending.

Research Protocols and Formulation Considerations

Clinical Trial Protocol (Topical)

The venous leg ulcer trial used LL-37 dissolved in solution at 0.5, 1.6, or 3.2 mg/mL, applied topically to chronic wounds twice weekly for four weeks. The diabetic foot ulcer trial used a cream formulation. Both protocols involved application to wound beds with existing tissue damage — not intact skin.

Reconstitution and Storage

  • Form: Typically supplied as lyophilized powder (research grade)
  • Reconstitution: Bacteriostatic water for injection
  • Storage: 2–8°C (36–46°F) for reconstituted solution. Lyophilized powder more stable at -20°C
  • Stability: LL-37 is relatively stable in wound fluid (~24 hours, PMID 21547341) but rapidly degraded in plasma
  • For detailed reconstitution protocols, see Peptidings [Reconstitution Guide](/guides/reconstitution/)
  • For storage best practices, see Peptidings [Storage Guide](/guides/storage/)

Dosing in Published Research

The following table summarizes dosing protocols for LL-37 as reported in published clinical and preclinical research. These reflect study designs, not treatment recommendations.

Published Clinical Dosing (Topical Only)

StudyRouteDoseFrequencyDurationResultPMID
Venous Leg Ulcer RCTTopical0.5 mg/mLTwice weekly4 weeks68% ulcer reduction (best dose)25041740
Venous Leg Ulcer RCTTopical1.6 mg/mLTwice weekly4 weeks50% ulcer reduction25041740
Venous Leg Ulcer RCTTopical3.2 mg/mLTwice weekly4 weeksNo better than placebo25041740
Diabetic Foot Ulcer RCTTopical creamNot specifiedTwice weekly4 weeksEnhanced healing, reduced inflammation37480520

Critical observation: The inverted dose-response curve (lower dose = better outcome) is consistent with LL-37's concentration-dependent biology and is a strong caution against the "more is better" assumption. For guidance on dosing principles, see Peptidings [More Is Not Always More Guide](/guides/more-is-more/).

PLAIN ENGLISH

The only published human doses are for skin application, not injection. The low dose worked best. The high dose did not work at all. This is a powerful reminder that with LL-37, more is not better — it may actually be worse.

Dosing in Self-Experimentation Communities

COMMUNITY-SOURCED INFORMATION

The dosing information below is drawn from community reports, forums, and anecdotal sources — not clinical trials. It reflects what people report using, not what has been validated by research. This is not medical advice.

WHY IS THIS SECTION NEARLY EMPTY?

LL-37 has limited community usage data. Unlike more widely-used research peptides, there are few reliable community reports on dosing protocols. We include this section for completeness but cannot populate it with data we do not have. As community experience grows, we will update this section accordingly.

Community Protocols — Observation, Not Endorsement

RouteCommon ProtocolEvidence BasisDose RangeKey Risks
Subcutaneous100–200 mcg daily or every other dayZero clinical support for injectable route50–300 mcg/injectionCancer promotion at ~5 μg/mL; no PK data; unknown tissue distribution
Intranasal100–200 mcg per spray, 1–2× dailyZero clinical supportVariableUnknown mucosal absorption; respiratory AMP dysregulation possible
Topical (wound)Applied to wound bedSupported by 2 RCTs (topical only)0.5 mg/mL (optimal per RCT)Low risk at studied doses; inverted dose-response — do not exceed

The injectable community protocol has no published clinical basis. Community users report subjective immune benefits (reduced infection frequency, faster illness recovery), but these reports are anecdotal, uncontrolled, and subject to placebo effect and confirmation bias.

CRITICAL DISCLAIMER

The community practice of injecting LL-37 subcutaneously has zero clinical trial support. The only human data is for topical wound application. If you inject LL-37, you are administering a compound with demonstrated cancer-promoting properties at relevant concentrations, through a route that has never been tested in humans, with no pharmacokinetic data to guide dosing. The vitamin D–LL-37 axis offers a safer alternative: adequate vitamin D supplementation (targeting serum 25(OH)D of 40–60 ng/mL) upregulates endogenous LL-37 production through the pathway your body was designed to use.

Combination Stacks

COMMUNITY-SOURCED INFORMATION

The dosing information below is drawn from community reports, forums, and anecdotal sources — not clinical trials. It reflects what people report using, not what has been validated by research. This is not medical advice.

Research into LL-37 combination protocols is limited. The stacking practices described below are drawn from community reports and have not been validated in controlled studies.

If you are considering combining LL-37 with other compounds, consult a qualified healthcare provider. Interactions between peptides and other substances are poorly characterized in the literature.

CompoundTypeEvidence TierVerdictMechanismPrimary Use CaseHuman DataFDA StatusWADA StatusKey Limitation
Thymosin Alpha-128-amino-acid peptide (thymus gland derivative)Tier 1 — Approved DrugStrong FoundationDendritic cell maturation + T-cell differentiation (Th1/Th17/Treg balance) + NK cell activation + TLR signaling enhancement; bidirectional immune modulationImmune modulation; hepatitis B/C adjunct; vaccine enhancement; cancer immunotherapy adjunct>11,000 in 30+ trials (Phase III TESTS sepsis N=3,600; HBV meta-analyses; adjuvant cancer trials)Approved as Zadaxin in 35+ countries (NOT US/EU); US Category 2 compoundingNot specifically named; thymic peptides not prohibitedUS access barrier (Category 2 compounding only); TESTS Phase III sepsis trial negative; evidence concentrated in Chinese/Italian institutions; geographic publication bias
LL-3737-amino-acid peptide (human cathelicidin — only human member)Tier 3 — Pilot / Limited Human DataEyes OpenDirect membrane disruption of pathogens + chemokine-like immune cell recruitment + TLR modulation + angiogenesis + wound healing via keratinocyte/fibroblast migration; vitamin D–regulated expression via CAMP geneInnate immune defense; wound healing; antimicrobial; anti-biofilm~74 across 2 small RCTs (venous leg ulcers N=34; diabetic foot ulcers N≈40) — all topical wound healingNot approvedNot specifically prohibitedCancer paradox (pro-tumorigenic at ~5 μg/mL in multiple cancers); route problem (injection destroys membrane-disruption advantage); two tiny topical RCTs only; no systemic human dosing data
KPVTripeptide (Lys-Pro-Val — C-terminal fragment of α-MSH)Tier 4 — Preclinical OnlyThin IceNF-κB suppression at nanomolar concentrations + MAPK/ERK inhibition + PepT1-mediated intestinal uptake (transporter upregulated during IBD); does NOT bind melanocortin receptorsAnti-inflammatory; IBD/gut inflammation; immune modulationNone — zero human studiesNot approvedNot specifically prohibitedZero human data; single research group dominance; nanoparticle formulation used in best studies not commercially available; raw peptide ≠ study formulation; route paradox (injection bypasses PepT1 gut transport)
CompoundTypePrimary TargetHalf-LifeFDA StatusWADA StatusEvidence TierPrimary Tissue TargetRouteHuman Evidence StatusKey Differentiator
BPC-157Synthetic pentadecapeptide (15 amino acids, derived from gastric protective protein BPC)VEGF / Nitric oxide (proposed multi-target)~2–6 hoursNot FDA-approvedProhibited — S0 (Non-Approved Substances)Tier 3 — Pilot / Limited Human DataMusculoskeletal, tendon, ligament, GI tract, CNSSubcutaneous injection + Oral (both routes studied)3 published human pilot studies (~30 subjects combined); no RCTsBroadest tissue tropism in cluster. Only injury-repair peptide with both oral and injectable evidence. Most evidence in rodent models
TB-500Synthetic 4-amino-acid fragment (residues 17–23 of Thymosin Beta-4)Actin binding (cell migration, angiogenesis)~2–3 hoursNot FDA-approvedProhibited — S2 (Peptide Hormones, Growth Factors, Related Substances and Mimetics)Tier 4 — Preclinical OnlyMusculoskeletal (muscle, tendon, ligament), cardiac, neurologicalSubcutaneous injectionZero published human clinical trials; animal models and cell culture onlySmallest fragment studied; synthetic derivative of endogenous Thymosin Beta-4. Actin sequestration may drive cell migration
Thymosin Beta-4Endogenous 43-amino-acid peptide (ubiquitous actin-sequestering protein)Actin binding, cell migration, angiogenesis~2–4 hoursNot FDA-approvedProhibited — S2 (Peptide Hormones, Growth Factors, Related Substances and Mimetics)Tier 3 — Pilot / Limited Human DataBroad: muscle, cardiac, neurological, immune, epithelialSubcutaneous injection + Topical (cosmetics)Few human studies; cardiac regeneration in early-stage human data; cosmetic formulationsFull-length parent peptide of TB-500. Endogenous compound; ubiquitous in mammalian tissues. More potent than TB-500 fragment in vitro
GHK-CuSynthetic tripeptide-copper complex (Gly-His-Lys chelated to Cu2+)Collagen synthesis, wound healing, TGF-beta modulation~2 hours topical; ~4–6 hours systemic (estimated)Not FDA-approved (topical in cosmetics; injectable investigational)Prohibited — S0 (injectable as growth factor analog); topical unregulatedTier 5 — It's ComplicatedDermal (collagen, elastin remodeling); broad systemic effects proposed but unverifiedTopical (cosmetics — extensive evidence) vs. Subcutaneous injection (preclinical only)Topical: 30+ years cosmetic use data; Injectable: zero human trialsRoute-dependent evidence: topical skin rejuvenation well-established, but injectable claims extrapolate from fundamentally different delivery
AHK-CuSynthetic copper tripeptide variant (Ala-His-Lys chelated to Cu2+)Copper chelation, extracellular matrix remodeling, growth factor signaling~2–4 hours (estimated)Not FDA-approvedNot WADA-listedTier 4 — Preclinical OnlyDermal (hair follicle, scalp), cosmeticTopical (cosmetics)No human clinical trials; in vitro and cosmetic formulation data onlyGHK-Cu structural analog with alanine substitution. Primarily studied for hair growth. Less evidence base than GHK-Cu
LL-37Human cathelicidin antimicrobial peptide (37 amino acids)Antimicrobial, wound healing, angiogenesis, vitamin D-regulated immune modulation~2–4 hoursNot FDA-approvedNot WADA-listedTier 3 — Pilot / Limited Human DataSkin, mucosal surfaces, immune systemSubcutaneous injection, TopicalLimited human data; antimicrobial efficacy well-characterized in vitro; wound healing in animal modelsEndogenous host defense peptide. Dual role: direct antimicrobial activity + immune modulation. Vitamin D pathway regulates expression
KPVAlpha-MSH C-terminal tripeptide (Lys-Pro-Val)NF-kB inhibition, anti-inflammatory (no melanocortin receptor activation)~1–2 hours (estimated)Not FDA-approvedNot WADA-listedTier 4 — Preclinical OnlyGI tract (colitis models), skin, immune systemSubcutaneous injection, Oral (investigational)No published human clinical trials; animal models (colitis, dermatitis) onlySmallest anti-inflammatory peptide in cluster (3 amino acids). NF-kB pathway without melanocortin receptor binding. GI-focused research
VIPEndogenous 28-amino-acid neuropeptide (vasoactive intestinal peptide)VPAC1/VPAC2 receptor agonism; vasodilation, immunomodulation, bronchodilation~1–2 minutes (extremely short)Not FDA-approved (aviptadil in clinical trials)Not WADA-listedTier 2 — Clinical TrialsPulmonary, GI tract, immune system, neurologicalSubcutaneous injection, IV infusion, IntranasalMultiple Phase 2 trials (ARDS, pulmonary hypertension, sarcoidosis); aviptadil in FDA pipelineShortest half-life in cluster. CIRS protocol use. Aviptadil (synthetic VIP) is furthest along FDA pathway among non-approved compounds here
KGF / PaliferminRecombinant keratinocyte growth factor (FGF-7)FGFR2b receptor; keratinocyte proliferation, epithelial barrier repair~3–5 hoursFDA-approved (Kepivance for oral mucositis)Not WADA-listedTier 1 — Approved DrugEpithelial surfaces (oral mucosa, GI tract, skin)Intravenous injection (FDA-approved route)FDA-approved for chemo-induced oral mucositis; multiple Phase 2/3 trialsOnly FDA-approved compound in Cluster B. Specific to epithelial tissues. IV-only approved route limits off-label accessibility
Substance PEndogenous 11-amino-acid tachykinin neuropeptideNK1 receptor agonism; fibroblast migration, angiogenesis, immune activation~1–2 minutesNot FDA-approvedNot WADA-listedTier 3 — Pilot / Limited Human DataCorneal epithelium, skin, nervous systemTopical (corneal), Subcutaneous injectionHuman data primarily in corneal wound healing; limited systemic human studiesEndogenous pain signaling peptide repurposed for tissue repair. Strongest human evidence in corneal healing. Dual role: nociception + repair
PRPAutologous platelet-rich plasma (concentrated growth factor preparation)PDGF, VEGF, TGF-beta release via platelet degranulationN/A (not a single molecule)FDA-cleared devices (not drug-approved)Prohibited — M1 (Manipulation of Blood and Blood Components)Tier 2 — Clinical TrialsMusculoskeletal (tendon, cartilage, bone), dermal, hairInjection (local to injury site)Hundreds of RCTs across orthopedic, dermatologic, and dental applicationsNon-peptide. Autologous preparation — no synthetic manufacturing. Largest clinical evidence base in cluster but high study heterogeneity
ARA-290Synthetic 11-amino-acid peptide (cibinetide; EPO-derived tissue-protective peptide)Innate Repair Receptor (EPOR/CD131 heterodimer) selective agonist~2–4 hoursNot FDA-approved (Phase 2b completed)Not WADA-listedTier 2 — Clinical TrialsPeripheral nerves, retina, cardiac, immune systemSubcutaneous injection (1–8 mg daily in trials); IV infusion (early trials)Phase 2b complete (sarcoidosis SFN — DOSARA trial); Phase 2 (diabetic neuropathy, diabetic macular edema)EPO-derived but does NOT bind classical EPO receptor. No erythropoietic activity. Tissue protection without blood doping risk. Furthest clinical development for neuropathy
CompoundTypeEvidence TierVerdictMechanismPrimary Use CaseHuman DataFDA StatusWADA StatusKey Limitation
Thymosin Alpha-128-amino-acid peptide (thymus gland derivative)Tier 1 — Approved DrugStrong FoundationDendritic cell maturation + T-cell differentiation (Th1/Th17/Treg balance) + NK cell activation + TLR signaling enhancement; bidirectional immune modulationImmune modulation; hepatitis B/C adjunct; vaccine enhancement; cancer immunotherapy adjunct>11,000 in 30+ trials (Phase III TESTS sepsis N=3,600; HBV meta-analyses; adjuvant cancer trials)Approved as Zadaxin in 35+ countries (NOT US/EU); US Category 2 compoundingNot specifically named; thymic peptides not prohibitedUS access barrier (Category 2 compounding only); TESTS Phase III sepsis trial negative; evidence concentrated in Chinese/Italian institutions; geographic publication bias
LL-3737-amino-acid peptide (human cathelicidin — only human member)Tier 3 — Pilot / Limited Human DataEyes OpenDirect membrane disruption of pathogens + chemokine-like immune cell recruitment + TLR modulation + angiogenesis + wound healing via keratinocyte/fibroblast migration; vitamin D–regulated expression via CAMP geneInnate immune defense; wound healing; antimicrobial; anti-biofilm~74 across 2 small RCTs (venous leg ulcers N=34; diabetic foot ulcers N≈40) — all topical wound healingNot approvedNot specifically prohibitedCancer paradox (pro-tumorigenic at ~5 μg/mL in multiple cancers); route problem (injection destroys membrane-disruption advantage); two tiny topical RCTs only; no systemic human dosing data
KPVTripeptide (Lys-Pro-Val — C-terminal fragment of α-MSH)Tier 4 — Preclinical OnlyThin IceNF-κB suppression at nanomolar concentrations + MAPK/ERK inhibition + PepT1-mediated intestinal uptake (transporter upregulated during IBD); does NOT bind melanocortin receptorsAnti-inflammatory; IBD/gut inflammation; immune modulationNone — zero human studiesNot approvedNot specifically prohibitedZero human data; single research group dominance; nanoparticle formulation used in best studies not commercially available; raw peptide ≠ study formulation; route paradox (injection bypasses PepT1 gut transport)

LL-37 belongs to a broader family of compounds being investigated for similar applications. The table below compares key characteristics across related compounds in the Immune Health cluster.

Mechanistic overlap does not imply equivalent evidence. Each compound has a distinct research profile, regulatory status, and level of clinical validation.

CompoundTypeEvidence TierVerdictMechanismPrimary Use CaseHuman DataFDA StatusWADA StatusKey Limitation
Thymosin Alpha-128-amino-acid peptide (thymus gland derivative)Tier 1 — Approved DrugStrong FoundationDendritic cell maturation + T-cell differentiation (Th1/Th17/Treg balance) + NK cell activation + TLR signaling enhancement; bidirectional immune modulationImmune modulation; hepatitis B/C adjunct; vaccine enhancement; cancer immunotherapy adjunct>11,000 in 30+ trials (Phase III TESTS sepsis N=3,600; HBV meta-analyses; adjuvant cancer trials)Approved as Zadaxin in 35+ countries (NOT US/EU); US Category 2 compoundingNot specifically named; thymic peptides not prohibitedUS access barrier (Category 2 compounding only); TESTS Phase III sepsis trial negative; evidence concentrated in Chinese/Italian institutions; geographic publication bias
LL-3737-amino-acid peptide (human cathelicidin — only human member)Tier 3 — Pilot / Limited Human DataEyes OpenDirect membrane disruption of pathogens + chemokine-like immune cell recruitment + TLR modulation + angiogenesis + wound healing via keratinocyte/fibroblast migration; vitamin D–regulated expression via CAMP geneInnate immune defense; wound healing; antimicrobial; anti-biofilm~74 across 2 small RCTs (venous leg ulcers N=34; diabetic foot ulcers N≈40) — all topical wound healingNot approvedNot specifically prohibitedCancer paradox (pro-tumorigenic at ~5 μg/mL in multiple cancers); route problem (injection destroys membrane-disruption advantage); two tiny topical RCTs only; no systemic human dosing data
KPVTripeptide (Lys-Pro-Val — C-terminal fragment of α-MSH)Tier 4 — Preclinical OnlyThin IceNF-κB suppression at nanomolar concentrations + MAPK/ERK inhibition + PepT1-mediated intestinal uptake (transporter upregulated during IBD); does NOT bind melanocortin receptorsAnti-inflammatory; IBD/gut inflammation; immune modulationNone — zero human studiesNot approvedNot specifically prohibitedZero human data; single research group dominance; nanoparticle formulation used in best studies not commercially available; raw peptide ≠ study formulation; route paradox (injection bypasses PepT1 gut transport)

Frequently Asked Questions

What is LL-37?

LL-37 is a 37-amino-acid antimicrobial peptide — the only cathelicidin produced by the human body. It is your primary innate immune defense molecule, killing bacteria, viruses, and fungi at mucosal surfaces and wound sites. It also modulates the immune response and promotes wound healing.

How does vitamin D affect LL-37?

Active vitamin D (1,25-dihydroxyvitamin D3) directly controls LL-37 production. The CAMP gene that encodes LL-37 has a vitamin D response element in its promoter region. When vitamin D levels are adequate, LL-37 production is maintained; when vitamin D drops, LL-37 production falls and innate immune defense weakens.

Has LL-37 been tested in humans?

Yes, but only as a topical wound treatment. Two small RCTs tested LL-37 applied to chronic skin wounds (venous leg ulcers and diabetic foot ulcers). Both showed improved healing. No human trial has tested LL-37 by injection for any purpose.

Does LL-37 cause cancer?

LL-37 has demonstrated pro-tumorigenic effects at approximately 5 μg/mL in ovarian, lung, breast, prostate cancers, melanoma, and skin squamous cell carcinoma. At higher concentrations, it shows anti-tumorigenic effects in colon, gastric, and blood cancers. The cancer risk is concentration- and tissue-dependent — it is not guaranteed, but it is documented and cannot be dismissed.

Is injecting LL-37 safe?

No injectable safety data exists in humans. The two clinical trials used topical application only. Injection introduces unknown variables: tissue distribution, sustained blood levels, potential cancer promotion at achievable concentrations, and unknown drug interactions.

Can I raise my LL-37 levels naturally?

Yes. Adequate vitamin D supplementation is the most evidence-backed way to support LL-37 production. Targeting serum 25(OH)D of 40–60 ng/mL optimizes the vitamin D–LL-37 axis. Sun exposure and dietary vitamin D also contribute, though supplementation is typically needed to reach optimal levels.

Why does the low dose work better than the high dose?

The inverted dose-response curve is consistent with LL-37's concentration-dependent biology. At low concentrations, LL-37 promotes healing and immune defense. At higher concentrations, it can become cytotoxic to human cells and promote tumor growth. More is not better with LL-37.

Does LL-37 work against MRSA?

In animal wound models, yes — LL-37 was effective against MRSA wound infections (PMC: 8532939). In vitro, it disrupts MRSA membranes. However, no human trial has tested LL-37 for MRSA or any bacterial infection.

Is LL-37 the same as cathelicidin?

LL-37 IS the human cathelicidin — it is the active, cleaved form of the precursor protein hCAP18. Humans have only one cathelicidin gene (CAMP), which produces only one active cathelicidin peptide (LL-37). Other species have multiple cathelicidins.

Can LL-37 worsen psoriasis or rosacea?

Potentially, yes. LL-37 is pathologically elevated in both conditions and is mechanistically involved in their inflammatory pathways. Exogenous LL-37 could theoretically worsen autoimmune skin conditions. If you have psoriasis or rosacea, exogenous LL-37 carries additional risk.

Is LL-37 banned by WADA?

Not currently. LL-37 is not specifically listed under any WADA prohibited category. Athletes should verify annually through the official WADA Prohibited List, as classifications can change.

How does LL-37 compare to Thymosin Alpha-1 for immune health?

They work through entirely different mechanisms. Thymosin Alpha-1 modulates adaptive immunity (T-cells, dendritic cells) and has extensive clinical trial data (>11,000 subjects, approved in 35+ countries). LL-37 is an innate immune effector (direct antimicrobial killing, immunomodulation) with only two small topical wound trials. For evidence-backed immune support, Thymosin Alpha-1 has a dramatically stronger clinical foundation.

---

Summary of Key Findings

LL-37 is the sole human cathelicidin — your body's most versatile innate immune defense molecule. It kills bacteria, viruses, and fungi directly, recruits and directs immune cells, and promotes wound healing. The vitamin D–LL-37 axis is one of the most important molecular connections in innate immunology.

1. Vitamin D controls LL-37 production. This is the most actionable finding: adequate vitamin D supplementation supports endogenous LL-37 expression through a well-characterized molecular mechanism. For most people, optimizing vitamin D is a safer approach to LL-37 support than exogenous administration.

2. Antimicrobial breadth is real. LL-37's activity against bacteria (including MRSA), viruses (RSV, influenza), and fungi (Candida auris) is well-documented in vitro and in animal models. Antibiotic synergy is demonstrated.

3. Human evidence is limited to topical wound healing. Two small RCTs showed efficacy for chronic wound healing with topical application. No injectable human data exists.

4. The cancer paradox is not optional reading. Pro-tumorigenic effects at ~5 μg/mL in multiple cancer types are documented. This risk applies to any exogenous LL-37 administration and cannot be dismissed.

5. Immune modulation goes beyond killing. LL-37 recruits immune cells, shapes inflammatory responses, neutralizes endotoxin, and bridges innate and adaptive immunity. It is a coordinator, not just a weapon.

6. Route matters profoundly. Topical wound data does not validate injectable immune claims. The community practice of injecting LL-37 for systemic immune support operates without any clinical trial foundation.

7. More is not better. The inverted dose-response in the venous leg ulcer trial — where the lowest dose was most effective — is consistent with LL-37's concentration-dependent biology and the cancer promotion concern.

PLAIN ENGLISH

LL-37 is a remarkable molecule — your body's Swiss Army knife for immune defense. The safest and most evidence-backed way to support it is through adequate vitamin D. The two wound-healing trials show real promise for topical use. But injecting LL-37 carries undefined risks, including cancer promotion, that have no clinical safety data to quantify.

Verdict Recapitulation

3Pilot / Limited Human Data
Eyes Open

LL-37 earns Tier 3 on the strength of two small but real clinical trials, both topical. The Eyes Open verdict reflects the gap between LL-37's fascinating biology and the safety unknowns of exogenous systemic administration — particularly the documented cancer-promoting effects at achievable concentrations. The vitamin D connection provides an evidence-backed alternative pathway to LL-37 support that does not carry the same risks.

For readers considering LL-37, the evidence above represents the current state of knowledge. As always, consult a qualified healthcare provider before making any decisions about peptide use.

Where to Source LL-37

Further Reading and Resources

If you want to go deeper on LL-37, the evidence landscape for immune health peptides, or the methodology behind how we evaluate this research, these are the places worth your time.

ON PEPTIDINGS

EXTERNAL RESOURCES

Selected References and Key Studies

  1. Heilborn JD, et al. (2014). "Treatment of hard-to-heal venous leg ulcers with LL-37: A randomized, double-blind, placebo-controlled Phase I/II clinical trial." Wound Repair and Regeneration. PMID 25041740
  2. Riwanto M, et al. (2023). "Topical LL-37 for diabetic foot ulcers with mild infection: A randomized controlled trial." Journal of Wound Care. PMID 37480520
  3. Vandamme D, et al. (2012). "A comprehensive summary of LL-37, the factotum human cathelicidin peptide." Cellular Immunology. PMID 23246832
  4. Coffelt SB, et al. (2009). "The pro-tumorigenic role of LL-37 in ovarian cancer." Molecular Cancer Research. PMID 19234121
  5. Ren SX, et al. (2022). "LL-37 inhibits pancreatic cancer growth by suppressing autophagy and reprogramming tumor immune microenvironment." PMC: 9355328
  6. Wu WK, et al. (2015). "The dual roles of LL-37 in cancer." Molecular Cancer. PMID 26395996
  7. Chen X, et al. (2018). "The roles of cathelicidin LL-37 in cancer." Frontiers in Oncology. PMID 29843147
  8. Liu PT, et al. (2006). "Toll-like receptor triggering of a vitamin D–mediated human antimicrobial response." Science. PMID 16497887
  9. Sørensen OE, et al. (2011). "LL-37 stability in wound fluid." PMID 21547341
  10. Turner J, et al. (2021). "LL-37 in a methicillin-resistant Staphylococcus aureus wound model." PMC: 8532939
  11. Currie SM, et al. (2016). "LL-37 inhibits RSV infection in polarized airway epithelium." PMID 26732674
  12. Tripathi S, et al. (2012). "LL-37 dose-dependent neutralization of influenza A." PMID 23052388
  13. Shurko JF, et al. (2022). "LL-37 triggers oxidative stress and cell cycle arrest in Candida auris." PMID 35205958
  14. von Haussen J, et al. (2011). "LL-37 as a growth factor for malignant melanoma." PMID 20977442

DISCLAIMER

LL-37 is not approved by the FDA for any indication in the United States. The information presented in this article is for educational and research purposes only. Nothing in this article constitutes medical advice, and no material here is intended to diagnose, treat, cure, or prevent any disease or health condition.

Consult a qualified healthcare provider before making any decisions about peptide use. Report adverse events to the FDA via MedWatch.

For the full Peptidings editorial methodology and evidence framework, visit our About page and Evidence Framework pages.

Article last reviewed: April 08, 2026. Next scheduled review: October 05, 2026.

Lawrence Winnerman

About the Author

Lawrence Winnerman

Founder of Peptidings.com. Former big tech product manager. Independent peptide researcher focused on translating clinical evidence into accessible science.


Scroll to Top