ACTH
What the Research Actually Shows
Human: 3 studies, 4 groups · Animal: 0 · In Vitro: 0
The most controversial peptide pharmaceutical in America—FDA-approved since 1952, prescribed for infantile spasms and autoimmune flares, and priced at over $38,000 a vial while scientists still debate exactly how it works
EDUCATIONAL NOTICE: Peptidings exists to make peptide research accessible and honest — not to tell you what to take. The information on this site is for educational and research purposes only. It is not medical advice, and no material here is intended to diagnose, treat, cure, or prevent any disease or health condition. Consult a qualified healthcare provider before making any decisions about peptide use.
AFFILIATE DISCLOSURE
This article contains links to partner services. We may earn a commission if you purchase through them, at no cost to you. This never influences our evidence assessments or editorial content. Full policy →
BLUF: Bottom Line Up Front
ACTH is a 39-amino acid hormone your pituitary gland makes every day. A pharmaceutical version called Acthar Gel has been FDA-approved since 1952 for conditions including infantile spasms, multiple sclerosis flares, and kidney disease. It works in two ways: it tells your adrenal glands to release cortisol, and it directly calms inflammation through melanocortin receptors on immune cells. That second mechanism is what makes ACTH different from simply taking a corticosteroid pill. The evidence is strongest for infantile spasms, where ACTH is considered standard of care. For other conditions, the evidence is real but often comes from older studies that would not meet today's clinical trial standards. Acthar Gel costs over $38,000 per vial—a price that has triggered congressional hearings—even though the drug itself has been around for seven decades.
ACTH sits at the intersection of three stories: old medicine, new science, and pharmaceutical economics at its most extreme. The hormone was identified in the 1930s, purified in the 1940s, and approved by the FDA in 1952—long before modern clinical trial requirements existed. For decades, it was understood simply as the body's signal to produce cortisol. Prescribe ACTH, stimulate cortisol, reduce inflammation. Straightforward.
Except that explanation has never fully held together. Physicians noticed that ACTH sometimes worked when corticosteroids alone did not—particularly in nephrotic syndrome and certain autoimmune flares. The past two decades of melanocortin research have begun to explain why: ACTH contains the alpha-MSH sequence within its first 13 amino acids, meaning it activates not just MC2R on the adrenal cortex but also MC1R, MC3R, and MC5R on immune cells and kidney podocytes. These non-steroidogenic effects may explain ACTH's therapeutic advantages over cortisol alone.
The pharmaceutical version—H.P. Acthar Gel, a porcine-derived ACTH preparation in a gelatin depot—is manufactured by Mallinckrodt Pharmaceuticals (with rights acquired by ANI Pharmaceuticals). Its price has risen from approximately $40 per vial in 2001 to over $38,000 per vial today. This pricing, combined with the drug's legacy evidence base and aggressive marketing, has generated FTC investigations, congressional scrutiny, and fierce debate over whether Acthar Gel offers meaningful clinical advantages over far cheaper corticosteroid alternatives.
In This Article
Quick Facts: ACTH at a Glance
Type
Natural 39-amino acid polypeptide hormone in porcine-derived gelatin depot formulation (H.P. Acthar Gel)
Also Known As
Adrenocorticotropic hormone, corticotropin, repository corticotropin injection, H.P. Acthar Gel, Acthar
Source
Porcine pituitary extraction; purified and formulated in gelatin depot for sustained release
Developer
Originally various; currently ANI Pharmaceuticals / Mallinckrodt Pharmaceuticals
Molecular Weight
~4,541 Da (ACTH 1-39)
Peptide Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF (human ACTH 1-39; Acthar uses porcine-derived form)
Primary Molecular Function
Dual mechanism: (1) MC2R activation on adrenal cortex → cortisol/corticosterone/aldosterone secretion; (2) MC1R/MC3R/MC5R activation on immune cells → direct anti-inflammatory effects independent of steroid production
Endogenous Origin
Anterior pituitary gland; cleaved from proopiomelanocortin (POMC) precursor; contains α-MSH sequence in first 13 amino acids
Alpha-MSH Overlap
ACTH 1-13 is identical to α-MSH—every dose of ACTH activates the full melanocortin receptor family, not just MC2R
UKISS Trial Result
Hormonal treatment (ACTH/prednisolone) stopped infantile spasms in 73% vs. 54% for vigabatrin (N=107, RCT, 2004)
MS Exacerbation Data
Rose et al. (1970): ACTH significantly faster recovery from MS exacerbations vs. placebo (N=197, RCT)
Nephrotic Syndrome Pilot
Hogan et al. (2013): 52% complete or partial remission in membranous nephropathy (N=21, open-label)
Clinical Programs
Approved for 19+ indications; modern RCTs exist for infantile spasms and MS; observational data for nephrotic syndrome, lupus, RA
Route
Intramuscular or subcutaneous injection (gelatin depot for sustained release); NOT available orally
FDA Status
APPROVED (1952). One of the oldest continuously approved biologics in the United States. 19+ labeled indications.
Cost
$38,000+ per vial (2025 US pricing)—up from ~$40/vial in 2001. Subject of FTC investigation and congressional scrutiny.
WADA Status
PROHIBITED (S2—Peptide Hormones, Growth Factors, Related Substances, and Mimetics)
Evidence Tier
1 Approved Drug
Verdict
Reasonable Bet
The research moves fast. We read all of it so you don’t have to.
New compound reviews, evidence updates, and protocol analysis — sourced, cited, and written for people who actually read the studies.
Subscribe to Peptidings WeeklyWhat Is ACTH?
Pronunciation: ay-see-tee-AYCH
Your brain is a pharmacy. Every morning, as your body wakes, the anterior pituitary gland cleaves a large precursor protein called POMC and releases a 39-amino acid messenger into the bloodstream: adrenocorticotropic hormone. This messenger travels to the adrenal glands sitting atop each kidney and delivers a single command—make cortisol. Within minutes, cortisol surges, glucose mobilizes, inflammation dials down, and your body is ready to face the day. This is the textbook story of ACTH.
ACTH's first 13 amino acids are identical to alpha-MSH—the master melanocortin peptide. This means ACTH doesn't just talk to adrenal glands. It activates MC1R on macrophages and skin cells, MC3R on neurons and immune cells, and MC5R on exocrine glands. These receptors don't produce cortisol. They suppress NF-κB signaling, reduce pro-inflammatory cytokines, and modulate immune function through pathways that have nothing to do with the adrenal cortex. ACTH is not merely a cortisol trigger—it is a broad-spectrum melanocortin agonist that happens to also stimulate steroid production.
H.P. Acthar Gel is the pharmaceutical version: purified porcine ACTH in a gelatin matrix designed for slow, sustained release after intramuscular or subcutaneous injection. It has been FDA-approved since 1952—predating the Salk polio vaccine—and carries more labeled indications than almost any other biologic in the United States.
PLAIN ENGLISH
ACTH is a natural hormone your brain makes every day to trigger cortisol production. But it also directly calms inflammation through a completely separate set of receptors on immune cells—something a cortisol pill cannot do. Acthar Gel is the injectable pharmaceutical version, approved for over 70 years.
Origins and Discovery
The story of ACTH begins in the 1930s, when researchers realized the pituitary gland controlled adrenal function. By 1943, Choh Hao Li and Herbert Evans at UC Berkeley had isolated ACTH from sheep pituitaries. The full 39-amino acid sequence was determined by the early 1950s, making ACTH one of the first peptide hormones fully characterized.
Commercial ACTH preparations appeared rapidly. The FDA approved repository corticotropin injection (Acthar Gel) in 1952 under regulatory standards that would be unrecognizable today—no Phase III RCTs, no placebo-controlled trials required. For decades, ACTH was prescribed as an alternative to cortisone for rheumatic diseases, allergic reactions, and inflammatory conditions. It was unremarkable, inexpensive, and widely available.
The modern ACTH story is primarily an economic one. Questcor Pharmaceuticals acquired the rights to Acthar Gel in 2001 for $100,000 and raised the price from approximately $40 per vial to over $28,000 by 2013. Mallinckrodt acquired Questcor in 2014 for $5.6 billion—largely on Acthar Gel's revenue. The FTC subsequently filed suit alleging Questcor had acquired a competing ACTH product (Synacthen) specifically to prevent competition. Mallinckrodt settled with the FTC for $100 million in 2017. The price has continued rising to over $38,000 per vial.
Meanwhile, the science took a genuinely interesting turn. Research into melanocortin receptors in the 1990s and 2000s revealed that ACTH's anti-inflammatory properties could not be fully explained by adrenal cortisol stimulation. The non-steroidogenic hypothesis—that ACTH provides immunomodulation through direct MCR activation on immune cells—reframed the compound from a simple cortisol trigger to a multi-target melanocortin drug. This hypothesis remains an active area of investigation and may ultimately determine whether Acthar Gel's clinical advantages over corticosteroids are real or marginal.
Mechanism of Action
The Steroidogenic Pathway (Classical)
ACTH binds MC2R on adrenal cortical cells with high affinity. MC2R is unique among melanocortin receptors: it requires MRAP (melanocortin-2 receptor accessory protein) for surface expression and is expressed almost exclusively on the adrenal cortex. Upon binding, MC2R activates adenylyl cyclase → cAMP → PKA → StAR protein upregulation → cholesterol transport into mitochondria → cortisol, corticosterone, and aldosterone synthesis. This is the classical hypothalamic-pituitary-adrenal (HPA) axis: CRH → ACTH → cortisol.
PLAIN ENGLISH
ACTH lands on specialized receptors on the adrenal gland and flips the switch for cortisol production. This is the textbook mechanism—the one everyone learns first.
The Non-Steroidogenic Pathway (Melanocortin Immunomodulation)
ACTH 1-13 is structurally identical to α-MSH. This means ACTH activates MC1R (expressed on macrophages, monocytes, dendritic cells, neutrophils, melanocytes, and podocytes), MC3R (neurons, macrophages, gut epithelium), and MC5R (exocrine glands, T lymphocytes). These receptors trigger anti-inflammatory cascades independent of cortisol:
MC1R activation → cAMP elevation → inhibition of NF-κB nuclear translocation → reduced production of TNF-α, IL-1β, IL-6, and IL-8 → increased IL-10 (anti-inflammatory). On renal podocytes, MC1R activation promotes cytoskeletal stabilization through RhoA/Rac1 signaling, potentially explaining ACTH's effects in nephrotic syndrome that corticosteroids alone do not replicate.
MC3R activation → modulation of macrophage efferocytosis (clearance of apoptotic cells) → resolution of inflammation rather than mere suppression. MC5R activation → regulation of sebaceous gland function and T-cell cytokine profiles.
PLAIN ENGLISH
ACTH doesn't just make cortisol. Because it contains the alpha-MSH sequence, it also directly talks to immune cells through melanocortin receptors—calming inflammation in ways that a cortisol pill simply cannot. This may explain why ACTH sometimes works when steroids alone fail.
Why This Matters Clinically
If ACTH's benefits were entirely due to cortisol stimulation, there would be no justification for prescribing it over far cheaper corticosteroid tablets. The non-steroidogenic hypothesis provides the only scientifically coherent argument for ACTH's continued clinical relevance—and for Acthar Gel's continued existence. However, definitive proof that MCR-mediated effects provide clinically meaningful advantages over corticosteroids in head-to-head trials remains incomplete.
Key Research Areas and Studies
Infantile Spasms — Standard of Care
The strongest evidence for ACTH is in infantile spasms (West syndrome), a catastrophic pediatric epilepsy syndrome. The 2004 UKISS trial (Lux et al., PMID 15351194) randomized 107 infants: hormonal treatment (ACTH or prednisolone) stopped spasms in 73% versus 54% for vigabatrin (p=0.043). Long-term follow-up showed improved neurodevelopmental outcomes in the hormonal treatment group for cryptogenic spasms. ACTH is considered first-line therapy for infantile spasms in most clinical guidelines, though the optimal dose, duration, and whether ACTH is superior to oral prednisolone remains debated.
Multiple Sclerosis Exacerbations
Rose et al. (1970, PMID 4913764) conducted the landmark trial: 197 patients with acute MS exacerbations randomized to ACTH IM or placebo. ACTH produced significantly faster recovery. This trial, despite its age, remains the basis for ACTH's MS indication. Modern MS treatment has largely moved to IV methylprednisolone for acute relapses, with ACTH reserved as an alternative when IV steroids are impractical or contraindicated.
Nephrotic Syndrome — The MCR Hypothesis in Action
Hogan et al. (2013, PMID 23620400) treated 21 patients with idiopathic membranous nephropathy using Acthar Gel 80 IU SC twice weekly for 12 months. Eleven of 21 (52%) achieved complete or partial remission. The significance: several patients responded who had previously failed corticosteroids—supporting the hypothesis that ACTH's effect on podocytes is mediated through MCR activation, not cortisol. This was a pilot study without a control group, and larger controlled trials have not been completed.
Real-World Evidence Program
Mallinckrodt funded multiple observational studies (2014–present) across approved indications including lupus, rheumatoid arthritis, dermatomyositis, and nephrotic syndrome. These studies generally show clinical improvement, but their design (open-label, no placebo control, industry-funded) limits the strength of the conclusions.
The Pricing Controversy and Scientific Questions
No discussion of ACTH is complete without addressing the central controversy: does H.P. Acthar Gel provide clinical benefits that justify a price exceeding $38,000 per vial, when synthetic ACTH analogs (cosyntropin/Cortrosyn) and direct corticosteroids cost a fraction as much?
The arguments favoring Acthar Gel center on the non-steroidogenic melanocortin mechanism: if ACTH provides immunomodulation through direct MCR activation on immune cells and podocytes, then it is not pharmacologically equivalent to a corticosteroid—and cosyntropin (ACTH 1-24, used diagnostically) has not been studied for therapeutic purposes in the same indications.
The arguments against: Acthar Gel was approved in 1952 under minimal regulatory standards. Many of its 19+ indications were grandfathered rather than proven through modern RCTs. The clinical evidence that ACTH provides meaningful advantages over corticosteroids in head-to-head comparison is thin for most indications. Synthetic ACTH (tetracosactide/Synacthen) is available in other countries at dramatically lower cost but was not marketed in the US after Questcor acquired the rights—an action the FTC challenged as anticompetitive.
PLAIN ENGLISH
The scientific question—does ACTH do something that cortisol pills cannot?—is genuinely important and still not definitively answered. The economic reality—a $38,000+ vial of a 70-year-old drug derived from pig pituitaries—has made ACTH one of the most scrutinized pharmaceuticals in America.
Claims vs. Evidence
| Claim | What the Evidence Shows | Verdict |
|---|---|---|
| “"ACTH is the best treatment for infantile spasms"” | UKISS RCT (N=107): hormonal treatment (ACTH/prednisolone) superior to vigabatrin for spasm cessation (73% vs. 54%). ACTH is standard of care in most guidelines. Whether ACTH is superior to oral prednisolone specifically remains debated. | Supported |
| “"ACTH speeds recovery from MS exacerbations"” | Rose et al. RCT (N=197): ACTH significantly faster recovery vs. placebo. Historic trial (1970). IV methylprednisolone is now preferred first-line; ACTH is an alternative. | Supported |
| “"ACTH works for nephrotic syndrome when steroids fail"” | Hogan pilot (N=21): 52% remission in membranous nephropathy, including steroid-refractory patients. Suggests MCR-mediated podocyte effect. Open-label, no control group. | Mixed Evidence |
| “"ACTH provides anti-inflammatory effects beyond cortisol"” | In vitro and animal data strongly support MCR-mediated immunomodulation independent of adrenal steroids. No definitive head-to-head human trial proving clinical superiority over corticosteroids for any indication. | Mixed Evidence |
| “"Acthar Gel is superior to synthetic ACTH (cosyntropin)"” | No head-to-head comparison exists. Cosyntropin (ACTH 1-24) retains the MCR-activating α-MSH sequence. The claim that Acthar's full 1-39 sequence or gelatin depot provides unique benefits is unproven. | Unsupported |
| “"ACTH treats lupus flares effectively"” | Observational data and case series show clinical improvement. No placebo-controlled RCT. Real-world evidence is industry-funded. | Mixed Evidence |
| “"ACTH treats rheumatoid arthritis"” | FDA-approved indication. Evidence is largely pre-modern. No contemporary RCT demonstrating superiority or equivalence to current RA biologics. | Mixed Evidence |
| “"ACTH is safe for long-term use"” | Side effect profile mirrors chronic corticosteroid use: Cushing syndrome, adrenal suppression, hyperglycemia, osteoporosis, infection risk. HPA axis suppression requires careful taper. 70+ years of clinical use provides extensive safety data, but long-term risks are significant. | Mixed Evidence |
| “"Acthar Gel's price reflects its unique value"” | Price has risen from ~$40 to $38,000+ per vial. FTC investigation found anticompetitive practices. No clinical evidence demonstrates outcomes sufficient to justify the pricing differential over corticosteroids. | Unsupported |
| “"ACTH can treat over 19 different conditions"” | Technically true—19+ FDA-approved indications. However, most were grandfathered from pre-modern regulatory era. Modern RCT-level evidence exists for only a subset (infantile spasms, MS exacerbations). | Mixed Evidence |
| “"ACTH activates melanocortin receptors on immune cells"” | Well-established in vitro and animal data. ACTH 1-13 = α-MSH, confirmed MC1R/MC3R/MC5R binding. The mechanism is real; the clinical significance in humans needs more evidence. | Supported |
| “"ACTH should be replaced by cheaper alternatives"” | Cosyntropin and corticosteroids are available at a fraction of the cost. For most indications, no evidence that Acthar Gel provides superior outcomes. For infantile spasms and potentially nephrotic syndrome, ACTH may provide unique benefits not replicated by corticosteroids alone—but the evidence is incomplete. | Mixed Evidence |
The Human Evidence Landscape
UKISS — Lux et al., 2004 (PMID 15351194)
Design: Multicenter RCT, N=107 infants with newly diagnosed infantile spasms. Intervention: Hormonal treatment (ACTH or oral prednisolone) vs. vigabatrin. Results: Spasm cessation at day 14: 73% hormonal vs. 54% vigabatrin (p=0.043). Long-term follow-up showed improved neurodevelopmental outcomes for cryptogenic spasms in the hormonal group. Limitations: The trial grouped ACTH and prednisolone together as "hormonal treatment"—the specific superiority of ACTH over prednisolone was not definitively established. US and UK dosing protocols differ.
Rose et al. — MS Exacerbation, 1970 (PMID 4913764)
Design: RCT, N=197 adults with acute MS exacerbation. Intervention: ACTH IM vs. placebo for 2–3 weeks. Results: ACTH produced significantly faster recovery from MS relapses. Limitations: This trial is over 50 years old. Modern MS treatment standards (IV methylprednisolone, disease-modifying therapies) have changed the landscape entirely. No contemporary head-to-head trial of ACTH vs. IV steroids for MS relapse exists.
Hogan et al. — Nephrotic Syndrome, 2013 (PMID 23620400)
Design: Pilot study (open-label), N=21 adults with idiopathic membranous nephropathy, many steroid-refractory. Intervention: Acthar Gel 80 IU SC twice weekly for 12 months. Results: 11/21 (52%) achieved complete or partial remission. Several patients who had failed corticosteroids responded to ACTH. Limitations: No control group. Small sample. Open-label design. The remission rate is promising but cannot be attributed solely to treatment without a comparator arm.
Becker et al. — Historical Review, 2023 (PMID 37792273)
Design: Narrative review. Contribution: Provides historical perspective on ACTH's clinical evolution and the emerging non-steroidogenic melanocortin hypothesis. Not primary evidence but useful for contextualizing the compound's unique position.
Real-World Evidence Studies (Mallinckrodt-funded)
Multiple observational studies across lupus, RA, dermatomyositis, and nephrotic syndrome. Generally positive outcomes reported. All are open-label, uncontrolled, and industry-funded—sufficient to support insurance coverage decisions but not to establish efficacy by modern evidence standards.
PLAIN ENGLISH
The best evidence: ACTH works for infantile spasms (one good RCT, standard-of-care status) and helps with MS flares (one historic RCT, largely superseded by modern treatments). The nephrotic syndrome pilot is intriguing—especially for patients who failed steroids—but lacks a control group. For most other approved indications, the evidence is old, observational, or industry-funded.
Safety, Risks, and Limitations
CRITICAL DISCLAIMER
ACTH stimulates cortisol production. Long-term use produces the same side effects as chronic corticosteroid therapy—including some that are serious and potentially irreversible.
Adrenal Effects
Prolonged ACTH use causes Cushing syndrome: moon face, central obesity, abdominal striae, glucose intolerance, hypertension, and skin thinning. These effects are dose-dependent and duration-dependent. Abrupt discontinuation after prolonged use causes HPA axis suppression → potential adrenal crisis. Taper protocols are mandatory.
Infection Risk
ACTH-induced immunosuppression increases susceptibility to bacterial, viral, and fungal infections. Latent tuberculosis may reactivate. Live vaccines are contraindicated during treatment.
Metabolic Effects
Hyperglycemia (may precipitate or worsen diabetes). Mineralocorticoid effects from aldosterone stimulation: sodium retention, potassium loss, hypertension, edema.
Bone and Muscle
Long-term use: osteoporosis, vertebral compression fractures, avascular necrosis. Proximal muscle weakness (steroid myopathy).
Psychiatric
Mood changes, insomnia, euphoria, depression, psychosis (rare but documented). Pediatric patients receiving ACTH for infantile spasms require close monitoring for irritability and hypertension.
Pediatric-Specific (Infantile Spasms)
High-dose ACTH in infants carries risks of hypertension, irritability, immunosuppression, and cardiac hypertrophy. Monitoring includes blood pressure, glucose, electrolytes, and infection surveillance. These risks are accepted because infantile spasms carry devastating neurodevelopmental consequences if untreated.
Drug Interactions
ACTH may reduce efficacy of anticoagulants, antidiabetic agents, and antihypertensives. Concurrent use with NSAIDs increases GI ulceration risk. CYP3A4 inducers may alter cortisol metabolism.
PLAIN ENGLISH
ACTH's side effects are essentially the same as taking high-dose steroids—because one of the things ACTH does is trigger your body to make steroids. The immune suppression, weight gain, bone loss, and mood changes are real and significant with long-term use. For short courses (infantile spasms, MS flares), the risks are manageable under medical supervision.
Legal and Regulatory Status
FDA Status
ACTH (H.P. Acthar Gel) has been FDA-approved since 1952 for a broad range of indications. Current labeled indications include: infantile spasms, MS exacerbations, nephrotic syndrome (idiopathic or lupus), rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, lupus (SLE), dermatomyositis/polymyositis, sarcoidosis, uveitis, serum sickness, and multiple other inflammatory conditions. Many of these indications were grandfathered from the pre-1962 regulatory framework.
WADA Status
PROHIBITED. ACTH is classified under S2—Peptide Hormones, Growth Factors, Related Substances, and Mimetics. Prohibited at all times (in-competition and out-of-competition). Detection: immunoassay of urine samples for exogenous ACTH.
FTC Investigation
The FTC filed suit against Mallinckrodt in 2017, alleging that Questcor's 2013 acquisition of the rights to Synacthen Depot (a competing synthetic ACTH product) was designed to eliminate potential competition for Acthar Gel. Mallinckrodt settled for $100 million and agreed to license Synacthen Depot to a competing manufacturer.
Pricing and Access
Acthar Gel's price trajectory ($40 → $38,000+ per vial) has been the subject of congressional hearings, state attorney general investigations, and insurance coverage disputes. Patient assistance programs and specialty pharmacies partially mitigate cost barriers, but access remains a significant issue.
Research Protocols and Formulation Considerations
Formulation
H.P. Acthar Gel is a repository (depot) formulation: purified porcine ACTH in a gelatin matrix designed for slow absorption after IM or SC injection. The depot formulation provides sustained ACTH release over hours, as opposed to the bolus delivery of synthetic cosyntropin (ACTH 1-24), which is used diagnostically for adrenal function testing (Cortrosyn stimulation test).
Administration
Intramuscular or subcutaneous injection. The gelatin matrix is viscous; proper injection technique matters. Vials require refrigerated storage (2–8°C).
Synthetic Alternatives
Cosyntropin (ACTH 1-24, Cortrosyn) retains the full MCR-binding sequence (the α-MSH fragment is within residues 1-13) and is used for diagnostic purposes but has not been studied therapeutically for Acthar Gel's indications in the US. Tetracosactide (Synacthen Depot) is a synthetic ACTH 1-24 depot formulation used therapeutically in Europe and other regions at a fraction of Acthar Gel's price.
Dosing in Published Research
The following table summarizes dosing protocols for ACTH as reported in published clinical and preclinical research. These reflect study designs, not treatment recommendations.
Published Clinical Dosing
| Indication | Dose | Route | Duration | Source |
|---|---|---|---|---|
| Infantile spasms | 150 IU/m² divided twice daily | IM | 2–3 weeks, then taper | UKISS protocol; AAP/AAN guidelines |
| MS exacerbations | 80–120 IU daily | IM | 2–3 weeks | Rose et al. 1970; FDA labeling |
| Nephrotic syndrome | 80 IU twice weekly | SC/IM | 6–12 months | Hogan et al. 2013 |
| Rheumatic conditions | 40–80 IU every 24–72 hours | IM | Variable (titrate to response) | FDA labeling |
PLAIN ENGLISH
ACTH doses vary widely depending on the condition. Infantile spasms use the highest doses for the shortest duration. Nephrotic syndrome uses lower doses for much longer. All dosing requires physician supervision and monitoring.
Dosing in Self-Experimentation Communities
WHY NO COMMUNITY DOSING SECTION?
ACTH is an FDA-approved prescription medication. Dosing is established by clinical guidelines and managed by prescribing physicians. Community “dosing protocols” for prescription medications can be dangerous and are not appropriate to present here. Consult your healthcare provider for dosing information.
ACTH (Acthar Gel) has no meaningful presence in self-experimentation or peptide communities. The compound is a prescription pharmaceutical available only through specialty pharmacies, priced at over $38,000 per vial. It is WADA-prohibited and not available from peptide vendors. There is no community dosing protocol to report.
Combination Stacks
COMMUNITY-SOURCED INFORMATION
The dosing information below is drawn from community reports, forums, and anecdotal sources — not clinical trials. It reflects what people report using, not what has been validated by research. This is not medical advice.
Research into ACTH combination protocols is limited. The stacking practices described below are drawn from community reports and have not been validated in controlled studies.
If you are considering combining ACTH with other compounds, consult a qualified healthcare provider. Interactions between peptides and other substances are poorly characterized in the literature.
| Compound | Type | Evidence Tier | Verdict | Primary Receptor | Primary Mechanism | Primary Application | Human Data | FDA Status | WADA Status | Key Limitation |
|---|---|---|---|---|---|---|---|---|---|---|
| Alpha-MSH | Endogenous tridecapeptide (13 aa, POMC-derived) | Tier 4 — Preclinical Only | Eyes Open | MC1R (non-selective across MC1/3/4/5) | MC1R → melanogenesis; NF-κB suppression → anti-inflammatory | Pigmentation (endogenous); anti-inflammatory (endogenous) | None therapeutic | Not developed (analogs approved) | Not prohibited | Half-life ~10 min; non-selective; not a drug candidate |
| Melanotan I | Synthetic linear tridecapeptide α-MSH analog | Tier 2 — Clinical Trials | Reasonable Bet | MC1R | MC1R agonist → eumelanin synthesis (100× potency vs α-MSH) | Photoprotective tanning; precursor to afamelanotide | Phase I (N=83); dose-dependent tanning | Not approved (became afamelanotide) | Not prohibited | Short half-life (~30 min); superseded by afamelanotide depot |
| Afamelanotide | Synthetic tridecapeptide (16 mg SC implant) | Tier 1 — Approved Drug | Strong Foundation | MC1R | MC1R → eumelanin synthesis + DNA repair enhancement | EPP phototoxicity prevention; vitiligo (Phase II) | Phase III RCT (N=74); long-term N=115; vitiligo N=55 | Approved October 2019 (Scenesse) for EPP | Not prohibited | Restricted to EPP (REMS); nevi darkening; melanoma monitoring |
| Setmelanotide | Synthetic cyclic octapeptide MC4R agonist | Tier 1 — Approved Drug | Strong Foundation | MC4R | MC4R → hypothalamic satiety signaling restoration | Monogenic obesity (POMC/PCSK1/LEPR/BBS deficiency) | Phase 3 (N=21 POMC/LEPR; N=32 BBS; N=18 VENTURE) | Approved November 2020 (IMCIVREE) | Not prohibited | Only works for genetically confirmed MC4R pathway defects; hyperpigmentation (78%) |
| ACTH | 39 aa polypeptide (porcine pituitary, gelatin depot) | Tier 1 — Approved Drug | Reasonable Bet | MC2R (primary); MC1/3/5R (secondary) | MC2R → adrenal cortisol; MCR → immunomodulation | Infantile spasms; MS exacerbation; nephrotic syndrome | RCTs (N=107 IS; N=197 MS); decades of clinical use | Approved 1952 (H.P. Acthar Gel) | Prohibited (S2) | ~$38K/vial pricing controversy; limited modern RCTs for most indications |
| PL-8177 | Synthetic selective MC1R agonist (oral formulation) | Tier 2 — Clinical Trials | Reasonable Bet | MC1R | MC1R → anti-inflammatory (NF-κB suppression in gut mucosa) | Ulcerative colitis; IBD | Phase 2 RCT (~N=60; 33% remission vs 0% placebo) | Not approved (Phase 2 complete) | Not prohibited | Phase 3 needed; full data not yet published |
Frequently Asked Questions
What is ACTH and what does Acthar Gel contain?
ACTH (adrenocorticotropic hormone) is a 39-amino acid hormone naturally produced by the pituitary gland. H.P. Acthar Gel is a pharmaceutical preparation containing purified porcine-derived ACTH in a gelatin matrix designed for slow, sustained release after injection. It has been FDA-approved since 1952.
How does ACTH differ from simply taking a corticosteroid?
ACTH stimulates your adrenal glands to produce cortisol, but it also directly activates melanocortin receptors (MC1R, MC3R, MC5R) on immune cells and kidney podocytes. These non-steroidogenic effects may provide anti-inflammatory benefits that corticosteroid pills cannot replicate—though definitive proof of clinical superiority in head-to-head trials remains incomplete.
Why is ACTH considered the connection between melanocortin science and approved medicine?
ACTH's first 13 amino acids are identical to alpha-MSH—the body's primary melanocortin signal. This structural overlap means ACTH activates the full family of melanocortin receptors. It is the only melanocortin receptor agonist (besides setmelanotide and afamelanotide) that is FDA-approved—and the oldest by decades.
What is the strongest evidence for ACTH's effectiveness?
Infantile spasms. The 2004 UKISS trial (N=107, RCT) showed ACTH/prednisolone stopped spasms in 73% of infants versus 54% with vigabatrin. ACTH is considered standard of care for this condition in most clinical guidelines. The MS exacerbation evidence (Rose 1970, N=197) is also from an RCT but is largely historic.
Why does Acthar Gel cost over $38,000 per vial?
Acthar Gel's price has increased over 900-fold since 2001, when Questcor Pharmaceuticals acquired the rights for $100,000. The price increases occurred under successive corporate owners. Critics argue the pricing exploits a legacy drug with limited modern evidence. Defenders argue the non-steroidogenic melanocortin mechanism provides unique therapeutic value. The FTC found the original company engaged in anticompetitive practices to block cheaper alternatives.
Is synthetic ACTH (cosyntropin) the same as Acthar Gel?
Cosyntropin (ACTH 1-24) retains the complete melanocortin receptor-binding sequence but is currently approved only as a diagnostic agent for adrenal function testing. Tetracosactide (Synacthen Depot) is a therapeutic synthetic ACTH 1-24 formulation available in Europe at a fraction of Acthar Gel's price. Whether the two formulations are clinically equivalent has never been tested in a head-to-head trial.
Why is ACTH prohibited by WADA?
ACTH stimulates cortisol and other steroid production from the adrenal glands—effectively an endogenous steroid booster. WADA classifies it under S2 (Peptide Hormones, Growth Factors) as prohibited at all times, both in-competition and out-of-competition. Exogenous ACTH is detectable via urine immunoassays.
What conditions is Acthar Gel approved to treat?
Acthar Gel carries 19+ FDA-approved indications including infantile spasms, MS exacerbations, nephrotic syndrome, rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, lupus, dermatomyositis/polymyositis, sarcoidosis, and uveitis. However, modern RCT-level evidence exists for only a subset of these indications.
What are the main side effects of ACTH treatment?
The side effect profile largely mirrors chronic corticosteroid therapy: Cushing syndrome (moon face, weight gain), adrenal suppression (requires taper), hyperglycemia, hypertension, osteoporosis, immunosuppression leading to infection risk, and mood changes. For infants receiving ACTH for spasms, hypertension and irritability require close monitoring.
Can ACTH help nephrotic syndrome when steroids fail?
Preliminary evidence is intriguing. The Hogan et al. pilot (N=21) showed 52% remission in membranous nephropathy, including patients who had failed conventional steroids—suggesting ACTH's effects on kidney podocytes may be mediated through melanocortin receptors rather than cortisol. However, this was an uncontrolled pilot study. Larger controlled trials are needed.
Is ACTH available from peptide vendors or research supply companies?
No. Acthar Gel is a prescription pharmaceutical distributed through specialty pharmacies. It is not available from peptide suppliers, research chemical vendors, or compounding pharmacies. Cosyntropin is available for diagnostic use under physician order.
How does ACTH relate to other melanocortin compounds on Peptidings?
ACTH is the endogenous \u0022grandparent\u0022 of melanocortin medicine. Its first 13 amino acids are alpha-MSH, which spawned melanotan I (afamelanotide), melanotan II, PT-141 (bremelanotide), setmelanotide, and PL-8177. Every melanocortin compound on this site can trace its pharmacological lineage back to the ACTH/α-MSH sequence.
Summary of Key Findings
ACTH occupies a unique position in medicine: a 70-year-old approved drug whose mechanism is still being rewritten. The steroidogenic pathway—ACTH tells adrenals to make cortisol—is textbook. The non-steroidogenic pathway—ACTH directly modulates immune cells through melanocortin receptors—is the frontier. The first pathway makes ACTH a cortisol trigger. The second may make it something more.
The clinical evidence is strongest for infantile spasms, where ACTH is standard of care based on the UKISS RCT (N=107). For MS exacerbations, the Rose 1970 trial (N=197) established efficacy, but IV methylprednisolone has largely replaced ACTH in modern practice. The nephrotic syndrome pilot (N=21) is the most scientifically provocative—patients who failed steroids responded to ACTH, suggesting melanocortin receptor effects on podocytes—but remains uncontrolled and small. For the majority of Acthar Gel's 19+ approved indications, the evidence predates modern clinical trial standards.
The pricing—over $38,000 per vial for a porcine-derived preparation of a hormone discovered in the 1940s—has generated FTC lawsuits, congressional scrutiny, and legitimate questions about whether the compound's clinical profile justifies its cost. Synthetic ACTH (tetracosactide) is available in other countries at dramatically lower prices but was blocked from the US market through practices the FTC found anticompetitive.
PLAIN ENGLISH
ACTH is a real drug that really works for certain conditions—especially infantile spasms. The science suggesting it does more than just boost cortisol is credible and genuinely interesting. But for most of its approved uses, the evidence is old, and the price is staggering. Whether ACTH's melanocortin benefits justify $38,000 a vial when corticosteroid pills cost a few dollars—that question remains unanswered by the kind of head-to-head trials that could settle it.
Verdict Recapitulation
ACTH earns Tier 1 on the basis of 70+ years of FDA approval and widespread clinical use. But the Reasonable Bet verdict—rather than Strong Foundation—reflects the gap between ACTH's regulatory status and the depth of its modern evidence base. For infantile spasms, the evidence would support Strong Foundation. For the vast majority of its other indications, the evidence is legacy, observational, or funded by the manufacturer. The non-steroidogenic melanocortin hypothesis is scientifically compelling but not yet proven in the controlled human trials that would convert it from hypothesis to established mechanism.
For readers considering ACTH, the evidence above represents the current state of knowledge. As always, consult a qualified healthcare provider before making any decisions about peptide use.
Where to Source ACTH
Further Reading and Resources
If you want to go deeper on ACTH, the evidence landscape for tanning & melanocortin peptides, or the methodology behind how we evaluate this research, these are the places worth your time.
ON PEPTIDINGS
- Tanning & Melanocortin Research Hub — Overview of all compounds in this cluster
- Reconstitution Guide — How to properly prepare injectable peptides
- Storage and Handling Guide — Proper storage to maintain peptide stability
- About Peptidings — Our editorial methodology and evidence framework
EXTERNAL RESOURCES
- PubMed: ACTH — All indexed publications
- ClinicalTrials.gov — Active and completed trials
Selected References and Key Studies
- Lux, A. L., et al. (2004). "The United Kingdom Infantile Spasms Study comparing vigabatrin with prednisolone or tetracosactide at 14 days: a multicentre, randomised controlled trial." The Lancet, 364(9447), 1773–1778. PMID 15351194
- Rose, A. S., et al. (1970). "Cooperative study in the evaluation of therapy in multiple sclerosis: ACTH vs. placebo." Neurology, 20(5), 1–59. PMID 4913764
- Hogan, J., et al. (2013). "Treatment of idiopathic membranous nephropathy with adrenocorticotropic hormone gel." American Journal of Nephrology, 38(5), 405–412. PMID 23620400
- Becker, D. E., et al. (2023). "Adrenocorticotropic hormone: From diagnostic tool to therapeutic agent—a historical and clinical perspective." Clinical Therapeutics, 45(11), e181–e192. PMID 37792273
DISCLAIMER
ACTH is an FDA-approved prescription medication. The information presented in this article is for educational purposes only. Off-label uses discussed here may not be supported by the same level of evidence as the approved indications. Always follow the guidance of your prescribing physician.
Consult a qualified healthcare provider before making any decisions about peptide use. Report adverse events to the FDA via MedWatch.
For the full Peptidings editorial methodology and evidence framework, visit our About page and Evidence Framework pages.
Article last reviewed: April 11, 2026. Next scheduled review: October 08, 2026.
